PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013605385.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 320aa    MW: 36277.5 Da    PI: 5.9051
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013605385.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l  +v+++G g W+t +++ g++R++k+c++rw +yl
   XP_013605385.1 15 KGAWTPEEDQKLTSYVNRHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 62
                     79********************************************97 PP

2Myb_DNA-binding52.51.2e-1668112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T++E+  ++ +++++G++ W++Iar ++ gRt++++k++w+++
   XP_013605385.1  68 RGEFTEDEERSIISLHALHGNK-WAAIARGLP-GRTDNEIKNYWNTH 112
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.6061062IPR017930Myb domain
SuperFamilySSF466892.31E-2912109IPR009057Homeodomain-like
SMARTSM007178.9E-131464IPR001005SANT/Myb domain
PfamPF002498.3E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-241669IPR009057Homeodomain-like
CDDcd001671.17E-81762No hitNo description
PROSITE profilePS5129425.33463117IPR017930Myb domain
SMARTSM007172.9E-1667115IPR001005SANT/Myb domain
PfamPF002491.8E-1568112IPR001005SANT/Myb domain
CDDcd001675.82E-1170113No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2570118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MVRTPCCRAE LGLKKGAWTP EEDQKLTSYV NRHGEGGWRT LPEKAGLKRC GKSCRLRWAN  60
YLRPDIKRGE FTEDEERSII SLHALHGNKW AAIARGLPGR TDNEIKNYWN THIKKRLIKK  120
GVDPVTHKSI SANLQDIPEK LNINQTIITS DDDLDHNKKM EKSARFLNRV ANRFGKRINQ  180
SVLSEIIGSG GPHATISNNT TTVTTSVTVD SKSDKSTSSS FTPTSNLLMT ANGNATSSPS  240
AFSESSISDR LMYWDKEDNI EFSTFLNDED FMVLEESCAE NNEFMKELTR FLQEDETDNI  300
EMMPVNEHQD SFEDIDNYFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5683720.0EU568372.1 Brassica oleracea clone BAC B59J16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013605385.10.0PREDICTED: transcription factor MYB51-like
SwissprotO497821e-154MYB51_ARATH; Transcription factor MYB51
TrEMBLA0A078CYH40.0A0A078CYH4_BRANA; BnaC08g37160D protein
TrEMBLA0A0D3DWN00.0A0A0D3DWN0_BRAOL; Uncharacterized protein
STRINGBra031035.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18570.11e-144myb domain protein 51